PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00042445001
Common NameGSBRNA2T00042445001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 324aa    MW: 35969.4 Da    PI: 9.1331
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00042445001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-3880140262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++++cprC++tntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
  GSBRNA2T00042445001  80 PQEKVNCPRCNATNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 140
                          6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3079138IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3282138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.42584138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDATKWTHDF QEMINVKPME QIISNTSNNT SQQQQQQQQQ QQTFIATTAR PNPNASNGGS  60
GAGNDNNTAT TMESTRKARP QEKVNCPRCN ATNTKFCYYN NYSLTQPRYF CKGCRRYWTE  120
GGSLRNVPVG GSSRKNKRSS TPLASPSNPK LPDLNPPFFF ATQIPNKSSK DLNLLSFPVM  180
QDHHHGMSQF LHMPKVENNN TSSSIYASSS HGASSRGMNT LLPGQMMDSN SVLYSSLGIP  240
TMADYKQSNN NLSFSIDHHQ GIGHNTINNN HRAEDNNHAD DMNGASRVLF PFSDTKEFSS  300
TNQEKSHNTY WSGMFSNTGG SSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.144942e-69seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794811e-175JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741906.10.0PREDICTED: dof zinc finger protein DOF3.7-like isoform X2
SwissprotQ433851e-172DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A078JGP60.0A0A078JGP6_BRANA; BnaCnng44400D protein
STRINGBra014418.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-165Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]